| 106_4 | |
| Organism | Mus musculus (mouse) |
| Function | Atg8 conjugation system |
| Cluster | 8 |
| Symbol | GABARAP |
| Synonyms | - |
| Gene Name | gamma-aminobutyric acid receptor associated protein |
| Other Name | Gabarap |
| Gene ID | 56486 |
| Nucleotide | NM_019749.4 |
| GI | 9789961 |
| Protein | NP_062723.1 |
| Genomic | AC_000033.1 NC_000077.6 NT_096135.6 NT_187026.1 NW_001030480.1 |
| UniProt | Q9DCD6 |
| Description | gamma-aminobutyric acid receptor associated protein |
| PDB Structure | - |
| Predicted Location | Endomembrane system. Cytoplasm, cytoskeleton. Golgi apparatus membrane. Cytoplasmic vesicle, autophagosome. |
| Complex | - |
| Interaction | - |
| Interaction (Human) | [Search PPI (67)] |
| VaProS | Q9DCD6 |
| Function (UniProt) | Ubiquitin-like modifier that play a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in apoptosis. Involved in autophagy. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity). |
| UniGene | Mm.272460 |
| Related Papers | 8889548 10349636 10899939 10900017 11042159 11076861 11146101 11217851 11890701 12466851 12477932 14610273 15365296 15489334 16141072 16141073 16307606 16602821 16874098 16954214 17916189 18451111 18497328 18799693 19225049 20010802 20354864 20577052 21267068 21383079 21388957 21677750 22033522 22049402 22948227 23427251 23671684 24089209 24240096 24747438 |
| Predicted Disordered Regions | - |
| Sequence | >NP_062723.1 MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |