| 107_4 | |
| Organism | Mus musculus (mouse) |
| Function | Atg8 conjugation system |
| Cluster | 8 |
| Symbol | GABARAPL1 |
| Synonyms | 3110025G09Rik 9130422N19Rik AI196471 Apg8l Atg8l GECI MNCb-0091 |
| Gene Name | gamma-aminobutyric acid (GABA) A receptor-associated protein-like 1 |
| Other Name | Gabarapl1 |
| Gene ID | 57436 |
| Nucleotide | NM_020590.4 |
| GI | 10181206 |
| Protein | NP_065615.1 |
| Genomic | AC_000028.1 NC_000072.6 NT_039353.8 NW_001030811.1 |
| UniProt | Q8R3R8 |
| Description | gamma-aminobutyric acid (GABA) A receptor-associated protein-like 1 |
| PDB Structure | - |
| Predicted Location | Cytoplasm, cytoskeleton. Cytoplasmic vesicle membrane. |
| Complex | - |
| Interaction | - |
| Interaction (Human) | [Search PPI (67)] |
| VaProS | Q8R3R8 |
| Function (UniProt) | Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity). |
| UniGene | Mm.14638 |
| Related Papers | 8889548 10349636 11042159 11076861 11217851 11374880 11414770 12466851 12477932 14530254 15292400 15489334 15782199 16141072 16141073 16602821 16704426 17727637 18451111 20010802 20577052 21267068 21388957 21597319 21691068 22079573 22948227 23690988 |
| Predicted Disordered Regions | - |
| Sequence | >NP_065615.1 MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK |