| 108_4 | |
| Organism | Mus musculus (mouse) |
| Function | Atg8 conjugation system |
| Cluster | 8 |
| Symbol | GABARAPL2 |
| Synonyms | 0610012F20Rik 2900019O08Rik AI173605 GATE-16 Gef2 |
| Gene Name | gamma-aminobutyric acid (GABA) A receptor-associated protein-like 2 |
| Other Name | Gabarapl2 |
| Gene ID | 93739 |
| Nucleotide | NM_026693.5 |
| GI | 31542873 |
| Protein | NP_080969.2 |
| Genomic | AC_000030.1 NC_000074.6 NT_078575.7 NW_001030904.1 |
| UniProt | P60521 |
| Description | gamma-aminobutyric acid (GABA) A receptor-associated protein-like 2 |
| PDB Structure | - |
| Predicted Location | Golgi apparatus. Cytoplasmicvesicle, autophagosome. |
| Complex | - |
| Interaction | - |
| Interaction (Human) | [Search PPI (67)] |
| VaProS | P60521 |
| Function (UniProt) | Ubiquitin-like modifier involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1 (By similarity). Involved in autophagy. Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. |
| UniGene | Mm.371666 |
| Related Papers | 8889548 10349636 10747018 10900017 10922068 11042159 11076861 11217851 11414770 11890701 12466851 12477932 14610273 15489334 15782199 16141072 16141073 16602821 18799693 20577052 21383079 |
| Predicted Disordered Regions | - |
| Sequence | >NP_080969.2 MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF |