| 153_4 | |
| Organism | Arabidopsis thaliana (thale cress) |
| Function | Atg8 conjugation system |
| Cluster | 8 |
| Symbol | ATG8G |
| Synonyms | AUTOPHAGY 8G |
| Gene Name | - |
| Other Name | - |
| Gene ID | 825235 |
| Nucleotide | NM_115928.4 |
| GI | 15232387 |
| Protein | NP_191623.1 |
| Genomic | NC_003074.8 |
| UniProt | Q9LZZ9 |
| Description | autophagy-related protein 8g |
| PDB Structure | - |
| Predicted Location | Cytoplasmic vesicle, cvt vesicle membrane. |
| Complex | - |
| Interaction | - |
| Interaction (Human) | [Search PPI (67)] |
| VaProS | Q9LZZ9 |
| Function (UniProt) | Ubiquitin-like modifier involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation. May mediate the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton (By similarity). |
| UniGene | At.27215 |
| Related Papers | 11130713 22589469 22737156 |
| Predicted Disordered Regions | [Dichot] |
| Sequence | >NP_191623.1 MSNVSFRQDHDFEKRKAEALRIREKYSDRVPVIVEKSEKSDIPNIDKKKYLVPADLTVGQFVYVIRKRIQLSAEKAIFIFVDNVLPPTGAMMSTIYDENKEEDGFLYVTYSGENTFGSSMT |