| 154_4 | |
| Organism | Arabidopsis thaliana (thale cress) |
| Function | Atg8 conjugation system |
| Cluster | 8 |
| Symbol | ATG8H |
| Synonyms | F24P17.11 F24P17_11 autophagy 8h |
| Gene Name | - |
| Other Name | - |
| Gene ID | 819816 |
| Nucleotide | NM_111517.3 |
| GI | 18397569 |
| Protein | NP_566283.1 |
| Genomic | NC_003074.8 |
| UniProt | Q8S925 |
| Description | autophagy-related protein 8h |
| PDB Structure | - |
| Predicted Location | Cytoplasmic vesicle, cvt vesicle membrane. |
| Complex | - |
| Interaction | - |
| Interaction (Human) | [Search PPI (67)] |
| VaProS | Q8S925 |
| Function (UniProt) | Ubiquitin-like modifier involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation. May mediate the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton (By similarity). |
| UniGene | At.40527 |
| Related Papers | 11130713 22589469 |
| Predicted Disordered Regions | [Dichot] |
| Sequence | >NP_566283.1 MGIVVKSFKDQFSSDERLKESNNIIAKYPDRIPVIIEKYSNADLPDMEKNKYLVPRDMTVGHFIHMLSKRMQLDPSKALFVFVHNTLPQTASRMDSLYNTFKEEDGFLYMCYSTEKTFG |