| 3204_4 | |
| Organism | Homo sapiens (human) |
| Function | Atg8 conjugation system |
| Cluster | 8 |
| Symbol | MAP1LC3B2 |
| Synonyms | ATG8G |
| Gene Name | microtubule-associated protein 1 light chain 3 beta 2 |
| Other Name | MAP1LC3B2 |
| Gene ID | 643246 |
| Nucleotide | NM_001085481.1 XM_011538652.1 |
| GI | 148277548 767975078 |
| Protein | NP_001078950.1 XP_011536954.1 |
| Genomic | NC_000012.12 NC_018923.2 NT_029419.13 NW_004929385.1 |
| UniProt | A6NCE7 |
| Description | microtubule-associated protein 1 light chain 3 beta 2 |
| PDB Structure | - |
| Predicted Location | Cytoplasm, cytoskeleton. Endomembrane system. |
| Complex | - |
| Interaction | - |
| Interaction (Human) | - |
| VaProS | A6NCE7 |
| Function (UniProt) | Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity). |
| UniGene | Hs.506947 |
| Related Papers | 16541075 19684603 21139048 21890473 24816145 |
| Predicted Disordered Regions | [Dichot] |
| Sequence | >NP_001078950.1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVCASQETFGMKLSV >XP_011536954.1 MRRMELNLFVPFFLSNSDEARGAAVSPRLSFAGTGMHRRWLSGRKIPFHFVLSLPPQGSQPPLGSAGPDPVPAALHGHSRIRCRSSRHPQEPPGPSRRRRRGPDPHTMPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVCASQETFGMKLSV |