| 3453_4 | |
| Organism | Bos taurus (cow) |
| Function | Atg8 conjugation system |
| Cluster | 8 |
| Symbol | GABARAPL1 |
| Synonyms | - |
| Gene Name | - |
| Other Name | - |
| Gene ID | 338472 |
| Nucleotide | NM_001033616.1 |
| GI | 75812928 |
| Protein | NP_001028788.1 |
| Genomic | AC_000162.1 NC_007303.5 NW_001495095.3 NW_003103939.1 |
| UniProt | Q8HYB6 |
| Description | GABA(A) receptor-associated protein like 1 |
| PDB Structure | - |
| Predicted Location | Cytoplasm, cytoskeleton. Cytoplasmic vesicle membrane. |
| Complex | - |
| Interaction | - |
| Interaction (Human) | [Search PPI (67)] |
| VaProS | Q8HYB6 |
| Function (UniProt) | Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity). |
| UniGene | Bt.43684 |
| Related Papers | 12438634 12477932 19393038 |
| Predicted Disordered Regions | - |
| Sequence | >NP_001028788.1 MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK |