| 3455_4 | |
| Organism | Bos taurus (cow) |
| Function | Atg8 conjugation system |
| Cluster | 8 |
| Symbol | MAP1LC3B |
| Synonyms | - |
| Gene Name | - |
| Other Name | - |
| Gene ID | 408001 |
| Nucleotide | NM_001001169.1 |
| GI | 47564106 |
| Protein | NP_001001169.1 |
| Genomic | AC_000175.1 NC_007316.5 NT_182040.1 NW_003104464.1 |
| UniProt | O41515 |
| Description | microtubule-associated protein 1 light chain 3 beta |
| PDB Structure | - |
| Predicted Location | Cytoplasm, cytoskeleton. Endomembranesystem. |
| Complex | - |
| Interaction | - |
| Interaction (Human) | [Search PPI (67)] |
| VaProS | O41515 |
| Function (UniProt) | Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity). Interacts with TBC1D5 (By similarity). |
| UniGene | Bt.64566 |
| Related Papers | 7908909 9557703 12477932 15140988 15325588 19393038 |
| Predicted Disordered Regions | [Dichot] |
| Sequence | >NP_001001169.1 MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPICEVYESEKDEDGFLYMVYASQETFGMKLSV |