| 3512_4 | |
| Organism | Bos taurus (cow) |
| Function | Atg8 conjugation system |
| Cluster | 8 |
| Symbol | MAP1LC3A |
| Synonyms | - |
| Gene Name | - |
| Other Name | - |
| Gene ID | 514547 |
| Nucleotide | NM_001046175.1 XM_005214696.1 |
| GI | 114051389 528973739 |
| Protein | NP_001039640.1 XP_005214753.1 |
| Genomic | AC_000170.1 NC_007311.5 NT_182020.1 NW_003104370.1 |
| UniProt | Q2HJ23 |
| Description | microtubule-associated protein 1 light chain 3 alpha |
| PDB Structure | - |
| Predicted Location | Cytoplasm, cytoskeleton. Endomembranesystem. |
| Complex | - |
| Interaction | - |
| Interaction (Human) | [Search PPI (67)] |
| VaProS | Q2HJ23 |
| Function (UniProt) | Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity). |
| UniGene | Bt.8073 |
| Related Papers | 19393038 |
| Predicted Disordered Regions | [Dichot] |
| Sequence | >NP_001039640.1 MPSDRPFKQRRSFADRCKEVQQIREQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF >XP_005214753.1 MPSDRPFKQRRSFADRCKEVQQIREQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF |