| 3729_4 | |
| Organism | Mus musculus (mouse) |
| Function | Atg8 conjugation system |
| Cluster | 8 |
| Symbol | Map1lc3a |
| Synonyms | 1010001H21Rik 4922501H04Rik LC3 LC3a |
| Gene Name | microtubule-associated protein 1 light chain 3 alpha |
| Other Name | Map1lc3a |
| Gene ID | 66734 |
| Nucleotide | NM_025735.3 NR_046364.1 |
| GI | 23956148 |
| Protein | NP_080011.1 |
| Genomic | AC_000024.1 NC_000068.7 NT_039207.8 NW_001030712.1 |
| UniProt | Q91VR7 |
| Description | microtubule-associated protein 1 light chain 3 alpha |
| PDB Structure | - |
| Predicted Location | Cytoplasm, cytoskeleton. Endomembranesystem. |
| Complex | - |
| Interaction | - |
| Interaction (Human) | [Search PPI (67)] |
| VaProS | Q91VR7 |
| Function (UniProt) | Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity). |
| UniGene | Mm.196239 |
| Related Papers | 8889548 10349636 11042159 11076861 11125038 11217851 11591653 12466851 12477932 14530254 15489334 15755735 15782199 16141072 16141073 16602821 17589504 17940279 18069693 18083104 18454133 18524774 18614564 18946037 19285958 19765191 19915056 20153330 20479004 20542253 20551175 20577052 20937856 21139567 21185285 21220506 21267068 21412437 21447143 21471385 21628531 21709020 21957238 21969579 22033522 22055344 22240590 22456507 22493260 22732589 22854957 22948227 23052835 23093945 23184977 23219390 23399561 23479732 23542691 23584039 23637164 23671684 23907538 23954414 23974797 24036476 24124537 24240988 24442442 25227738 25544559 |
| Predicted Disordered Regions | - |
| Sequence | >NP_080011.1 MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF |