| 3733_4 | |
| Organism | Mus musculus (mouse) |
| Function | Atg8 conjugation system |
| Cluster | 8 |
| Symbol | Map1lc3b |
| Synonyms | 1010001C15Rik Atg8 LC3b Map1lc3 |
| Gene Name | microtubule-associated protein 1 light chain 3 beta |
| Other Name | Map1lc3b |
| Gene ID | 67443 |
| Nucleotide | NM_026160.4 |
| GI | 13385664 |
| Protein | NP_080436.1 |
| Genomic | AC_000030.1 NC_000074.6 NT_078575.7 NW_001030904.1 |
| UniProt | Q9CQV6 |
| Description | microtubule-associated protein 1 light chain 3 beta |
| PDB Structure | - |
| Predicted Location | Cytoplasm, cytoskeleton. Endomembranesystem. |
| Complex | - |
| Interaction | - |
| Interaction (Human) | [Search PPI (67)] |
| VaProS | Q9CQV6 |
| Function (UniProt) | Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity). |
| UniGene | Mm.28357 |
| Related Papers | 8889548 10349636 10922068 11042159 11076861 11085878 11217851 11890701 12088839 12466851 12477932 12890687 15325588 15489334 15782199 16141072 16141073 16602821 17077144 17589504 18069693 18097414 18768753 19176312 19915056 20551175 20577052 20889906 20956295 21151103 21185285 21383079 21471385 21677750 21681844 21957238 22055190 22055344 22095627 22138575 22371349 22783020 22904094 22968077 23052835 23333919 23431188 23542691 24089209 24095928 24185898 24200693 24566975 24591579 24747438 24879152 24909277 25227738 |
| Predicted Disordered Regions | [Dichot] |
| Sequence | >NP_080436.1 MPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFGTAMAV |