| 3884_4 | |
| Organism | Rattus norvegicus (rat) |
| Function | Atg8 conjugation system |
| Cluster | 8 |
| Symbol | Gabarap |
| Synonyms | - |
| Gene Name | GABA(A) receptor-associated protein |
| Other Name | Gabarap |
| Gene ID | 58974 |
| Nucleotide | NM_172036.3 |
| GI | 25282439 |
| Protein | NP_742033.1 |
| Genomic | AC_000078.1 NC_005109.4 NW_001084656.1 NW_007905922.1 |
| UniProt | P60517 |
| Description | GABA(A) receptor-associated protein |
| PDB Structure | 1KJT |
| Predicted Location | Endomembrane system. Cytoplasm,cytoskeleton. Golgi apparatus membrane. Cytoplasmic vesicle,autophagosome. |
| Complex | - |
| Interaction | - |
| Interaction (Human) | [Search PPI (67)] |
| VaProS | P60517 |
| Function (UniProt) | Involved in apoptosis (By similarity). May play a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in autophagy (By similarity). |
| UniGene | Rn.8411 |
| Related Papers | 10899939 10900017 11461150 11818336 12477932 15325588 15489334 15601949 15814572 16431922 17581952 17916189 18027972 18160640 19766149 20562859 24240096 |
| Predicted Disordered Regions | - |
| Sequence | >NP_742033.1 MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |