| 3891_4 | |
| Organism | Rattus norvegicus (rat) |
| Function | Atg8 conjugation system |
| Cluster | 8 |
| Symbol | Gabarapl2 |
| Synonyms | Gef2 |
| Gene Name | GABA(A) receptor-associated protein like 2 |
| Other Name | Gabarapl2 |
| Gene ID | 64670 |
| Nucleotide | NM_022706.2 |
| GI | 12083673 |
| Protein | NP_073197.1 |
| Genomic | AC_000087.1 NC_005118.4 NW_001084744.1 NW_007906038.1 |
| UniProt | P60522 |
| Description | GABA(A) receptor-associated protein like 2 |
| PDB Structure | - |
| Predicted Location | Golgi apparatus. Cytoplasmicvesicle, autophagosome. |
| Complex | - |
| Interaction | - |
| Interaction (Human) | [Search PPI (67)] |
| VaProS | P60522 |
| Function (UniProt) | Ubiquitin-like modifier involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1. Involved in autophagy. Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity). |
| UniGene | Rn.64537 |
| Related Papers | 10747018 11414770 12477932 15325588 15489334 20562859 |
| Predicted Disordered Regions | - |
| Sequence | >NP_073197.1 MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF |