| 3892_4 | |
| Organism | Rattus norvegicus (rat) |
| Function | Atg8 conjugation system |
| Cluster | 8 |
| Symbol | Map1lc3b |
| Synonyms | Map1lc3 Mpl3 zbs559 |
| Gene Name | microtubule-associated protein 1 light chain 3 beta |
| Other Name | Map1lc3b |
| Gene ID | 64862 |
| Nucleotide | NM_022867.2 |
| GI | 41054912 |
| Protein | NP_074058.2 |
| Genomic | AC_000087.1 NC_005118.4 NW_001084744.1 NW_007906040.1 |
| UniProt | Q62625 |
| Description | microtubule-associated protein 1 light chain 3 beta |
| PDB Structure | 1UGM 2K6Q 2Z0D 2Z0E 2ZZP |
| Predicted Location | Cytoplasm, cytoskeleton. Endomembrane system. |
| Complex | - |
| Interaction | - |
| Interaction (Human) | [Search PPI (67)] |
| VaProS | Q62625 |
| Function (UniProt) | Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity). |
| UniGene | Rn.41412 |
| Related Papers | 7908909 11060023 12371906 12477932 14760703 15095872 15169837 15325588 15489334 16300744 16854843 20562859 24351649 24747438 |
| Predicted Disordered Regions | [Dichot] |
| Sequence | >NP_074058.2 MPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFGTALAV |