| 4033_4 | |
| Organism | Rattus norvegicus (rat) |
| Function | Atg8 conjugation system |
| Cluster | 8 |
| Symbol | Map1lc3a |
| Synonyms | - |
| Gene Name | microtubule-associated protein 1 light chain 3 alpha |
| Other Name | Map1lc3a |
| Gene ID | 362245 |
| Nucleotide | NM_199500.2 |
| GI | 41054834 |
| Protein | NP_955794.1 |
| Genomic | AC_000071.1 NC_005102.4 NW_001084816.1 NW_007905768.1 |
| UniProt | Q6XVN8 |
| Description | microtubule-associated protein 1 light chain 3 alpha |
| PDB Structure | - |
| Predicted Location | Cytoplasm, cytoskeleton. Endomembranesystem. |
| Complex | - |
| Interaction | - |
| Interaction (Human) | [Search PPI (67)] |
| VaProS | Q6XVN8 |
| Function (UniProt) | Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity). |
| UniGene | Rn.3135 |
| Related Papers | 7908909 11060023 12477932 15187094 15325588 15489334 16300744 16420522 17665967 19337031 19366727 20132792 20204693 20562859 21455601 21631941 22005460 22421968 23665054 |
| Predicted Disordered Regions | - |
| Sequence | >NP_955794.1 MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF |