| 4074_4 | |
| Organism | Rattus norvegicus (rat) |
| Function | Atg8 conjugation system |
| Cluster | 8 |
| Symbol | Gabarapl1 |
| Synonyms | Gec1 |
| Gene Name | GABA(A) receptor-associated protein like 1 |
| Other Name | Gabarapl1 |
| Gene ID | 689161 |
| Nucleotide | NM_001044294.1 |
| GI | 112982886 |
| Protein | NP_001037759.1 |
| Genomic | AC_000072.1 NC_005103.4 NW_001084832.1 NW_007905797.1 |
| UniProt | Q0VGK0 |
| Description | GABA(A) receptor-associated protein like 1 |
| PDB Structure | - |
| Predicted Location | Cytoplasm, cytoskeleton. Cytoplasmic vesicle membrane. |
| Complex | - |
| Interaction | - |
| Interaction (Human) | [Search PPI (67)] |
| VaProS | Q0VGK0 |
| Function (UniProt) | Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity). |
| UniGene | Rn.118264 |
| Related Papers | 12477932 16650615 18423580 19524128 20562859 22120110 |
| Predicted Disordered Regions | - |
| Sequence | >NP_001037759.1 MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK |