| 4345_4 | |
| Organism | Dictyostelium discoideum AX4 |
| Function | Atg8 conjugation system |
| Cluster | 8 |
| Symbol | atg8 |
| Synonyms | DDBDRAFT_0186913 DDBDRAFT_0191413 DDB_0186913 DDB_0191413 |
| Gene Name | - |
| Other Name | - |
| Gene ID | 8625555 |
| Nucleotide | XM_632749.1 |
| GI | 66808237 |
| Protein | XP_637841.1 |
| Genomic | NC_007090.3 |
| UniProt | Q86CR8 |
| Description | autophagy protein 8 |
| PDB Structure | - |
| Predicted Location | Cytoplasmic vesicle, autophagosome membrane. |
| Complex | - |
| Interaction | - |
| Interaction (Human) | [Search PPI (67)] |
| VaProS | Q86CR8 |
| Function (UniProt) | Ubiquitin-like modifier involved in autophagosomes formation. Participates in membrane fusion events that take place in the secretory pathway (By similarity). |
| UniGene | - |
| Related Papers | 14736886 15875012 17878305 24772931 |
| Predicted Disordered Regions | [Dichot] |
| Sequence | >XP_637841.1 MVHVSSFKNDHPLDKRREVAERIRSKYLDRIPVIVEKAPRSDAPDIDKKKYLVPADITVGKFVYEIRKHMTKVSAEKAIYLFVNNTIPPTAALISQIYERYKDEDGFLYITYSGENTFGSDL |