52_4 | |
Organism | Homo sapiens (human) |
Function | Atg8 conjugation system |
Cluster | 8 |
Symbol | GABARAP |
Synonyms | ATG8A GABARAP-a MM46 |
Gene Name | GABA(A) receptor-associated protein |
Other Name | GABARAP |
Gene ID | 11337 |
Nucleotide | NM_007278.1 |
GI | 6005764 |
Protein | NP_009209.1 |
Genomic | NC_000017.11 NC_018928.2 NT_010718.17 NW_004929405.1 |
UniProt | O95166 Q6IAW1 |
Description | GABA(A) receptor-associated protein |
PDB Structure | 1GNU 1KLV 1KM7 1KOT 3D32 3DOW 3WIM 4XC2 |
Predicted Location | - |
Complex | - |
Interaction | [PPI (19)] |
Interaction (Human) | - |
VaProS | O95166 Q6IAW1 |
Function (UniProt) | Ubiquitin-like modifier that plays a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in apoptosis. Involved in autophagy. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. |
UniGene | Hs.647421 |
Related Papers | 9892355 10856287 10899939 10900017 10931946 10984509 11042152 11096062 11146101 11414770 11461150 11727985 11727986 11729197 11779480 11825910 11875056 11885988 11890701 11948245 11979730 11997026 12367594 12477932 12507496 14625090 15169837 15695379 15977068 16169070 16303767 16339017 16874098 17164261 17353931 17581966 18638487 18976975 19056683 19154346 19250911 19363302 19533740 20010802 20111057 20562859 20639871 20665069 20706999 20820800 21139048 21376781 21383079 21617041 21684337 21890473 22505724 22939629 22948227 23043107 23209807 23545901 23602568 23721406 24100292 24198379 24240096 24582747 24686084 24816145 24879152 25015289 25126726 25126728 25147182 25215947 25224329 25498145 |
Predicted Disordered Regions | [Dichot] |
Sequence | >NP_009209.1 MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |