54_4
Organism Homo sapiens (human)
Function Atg8 conjugation system
Cluster 8
Symbol GABARAPL2
Synonyms ATG8 ATG8C GATE-16 GATE16 GEF-2 GEF2
Gene Name GABA(A) receptor-associated protein-like 2
Other Name GABARAPL2
Gene ID 11345
Nucleotide NM_007285.6
GI 6005768
Protein NP_009216.1
Genomic NC_000016.10 NC_018927.2 NT_010498.16 NW_004929402.1
UniProt P60520
Description GABA(A) receptor-associated protein-like 2
PDB Structure 4CO7
Predicted Location Golgi apparatus. Cytoplasmicvesicle, autophagosome.
Complex -
Interaction [PPI (21)]
Interaction (Human) -
VaProS P60520
Function (UniProt) Ubiquitin-like modifier involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1 (By similarity). Involved in autophagy. Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
UniGene Hs.461379
Related Papers 10747018 11076863 11096062 11146101 11256614 11414770 11825910 11890701 12473658 12477932 12507496 12581858 15169837 15489334 15489336 15604093 16169070 16189514 16303767 16381901 17353931 18187620 18768753 18776740 19056683 19250911 19322201 19533740 19549685 19635843 19844255 20010802 20010805 20029029 20468064 20562859 21139048 21177865 21383079 21460636 21497758 21617041 21669198 21684337 21832049 21890473 21900206 21988832 22354992 22421968 22885598 23043107 23112293 23142642 23891751 24269818 24550385 24582747 24747438 24816145 25147182 25416956
Predicted Disordered Regions
[Dichot]
Sequence
>NP_009216.1
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF