| 591_4 | |
| Organism | Cryptococcus neoformans var. neoformans JEC21 |
| Function | Atg8 conjugation system |
| Cluster | 8 |
| Symbol | CNA07930 |
| Synonyms | - |
| Gene Name | - |
| Other Name | - |
| Gene ID | 3253893 |
| Nucleotide | XM_567139.1 |
| GI | 58259453 |
| Protein | XP_567139.1 |
| Genomic | NC_006670.1 |
| UniProt | P0CO54 |
| Description | microtubule binding protein |
| PDB Structure | - |
| Predicted Location | Cytoplasmic vesicle, cvt vesicle membrane. |
| Complex | - |
| Interaction | - |
| Interaction (Human) | [Search PPI (67)] |
| VaProS | P0CO54 |
| Function (UniProt) | Involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation. May mediate the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton (By similarity). |
| UniGene | Fne.6688 |
| Related Papers | 15653466 |
| Predicted Disordered Regions | [Dichot] |
| Sequence | >XP_567139.1 MVRSKFKDEHPFDKRKAEAERIRQKYQDRIPVICEKAEKSDIPTIDKKKYLVPADLTVGQFVYVIRKRIKLAPEKAIFIFVDDILPPTAALMSSIYDEHKDEDGFLYVLYASENTFGDLEQYAISE |