70572_4
Organism Homo sapiens (human)
Function Atg8 conjugation system
Cluster 8
Symbol CTDNEP1
Synonyms DULLARD HSA011916 NET56
Gene Name CTD nuclear envelope phosphatase 1
Other Name CTDNEP1
Gene ID 23399
Nucleotide NM_001143775.1 NM_015343.4
GI 219555649 31542547
Protein NP_001137247.1 NP_056158.2
Genomic NC_000017.11 NC_018928.2 NT_010718.17 NW_004929405.1
UniProt O95476
Description CTD nuclear envelope phosphatase 1
PDB Structure -
Predicted Location Endoplasmic reticulum membrane.
Complex -
Interaction -
Interaction (Human) -
VaProS O95476
Function (UniProt) Serine/threonine protein phosphatase forming with CNEP1R1 an active phosphatase complex that dephosphorylates and may activate LPIN1 and LPIN2. LPIN1 and LPIN2 are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at differents levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol. May antagonize BMP signaling.
UniGene Hs.513913
Related Papers 12083771 12477932 17141153 17157258 17420445 21139048 21413788 22134922 22658674
Predicted Disordered Regions -
Sequence
>NP_001137247.1
MMRTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW
>NP_056158.2
MMRTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW