| 70589_4 | |
| Organism | Oryctolagus cuniculus (European rabbit) |
| Function | Atg8 conjugation system |
| Cluster | 8 |
| Symbol | GABARAP |
| Synonyms | - |
| Gene Name | - |
| Other Name | - |
| Gene ID | 100008883 |
| Nucleotide | NM_001082142.1 |
| GI | 126722601 |
| Protein | NP_001075611.1 |
| Genomic | NC_013687.1 NW_003159312.1 |
| UniProt | Q8MK68 |
| Description | GABA(A) receptor-associated protein |
| PDB Structure | - |
| Predicted Location | Endomembrane system. Cytoplasm, cytoskeleton. Golgi apparatus membrane. Cytoplasmic vesicle, autophagosome. |
| Complex | - |
| Interaction | - |
| Interaction (Human) | [Search PPI (67)] |
| VaProS | Q8MK68 |
| Function (UniProt) | Ubiquitin-like modifier that play a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in apoptosis. Involved in autophagy. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity). |
| UniGene | Ocu.6215 |
| Related Papers | - |
| Predicted Disordered Regions | - |
| Sequence | >NP_001075611.1 MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |