| 70606_4 | |
| Organism | Cavia porcellus (guinea pig) |
| Function | Atg8 conjugation system |
| Cluster | 8 |
| Symbol | Gabarapl1 |
| Synonyms | GEC-1 GEC1 |
| Gene Name | - |
| Other Name | - |
| Gene ID | 100135524 |
| Nucleotide | NM_001172950.1 |
| GI | 290543460 |
| Protein | NP_001166421.1 |
| Genomic | NT_176391.1 |
| UniProt | P60518 |
| Description | gamma-aminobutyric acid (GABA) A receptor-associated protein-like 1 |
| PDB Structure | - |
| Predicted Location | Cytoplasm, cytoskeleton. Cytoplasmic vesicle membrane. |
| Complex | - |
| Interaction | - |
| Interaction (Human) | [Search PPI (67)] |
| VaProS | P60518 |
| Function (UniProt) | Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity). |
| UniGene | - |
| Related Papers | 8495796 11374880 |
| Predicted Disordered Regions | - |
| Sequence | >NP_001166421.1 MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK |