8_4
Organism Saccharomyces cerevisiae (baker's yeast)
Function Atg8 conjugation system
Cluster 8
Symbol ATG8
Synonyms APG8 AUT7 CVT5
Gene Name -
Other Name -
Gene ID 852200
Nucleotide NM_001178318.1
GI 6319393
Protein NP_009475.1
Genomic NC_001134.8
UniProt P38182
Description ubiquitin-like protein ATG8
PDB Structure 2KQ7 2KWC 2LI5 2ZPN 3RUI 3VH3 3VH4 3VXW
Predicted Location Cytoplasmic vesicle, cvt vesicle membrane.
Complex -
Interaction -
Interaction (Human) [Search PPI (67)]
VaProS P38182
Function (UniProt) Ubiquitin-like modifier involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation. With ATG4, mediates the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Participates also in membrane fusion events that take place in the early secretory pathway. Also involved in endoplasmic reticulum-specific autophagic process and is essential for the survival of cells subjected to severe ER stress. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation is an important step required to facilitate multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of Atg9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. Plays also a role in regulation of filamentous growth.
UniGene -
Related Papers 7813418 8849441 9649430 10525546 10688190 10837468 11038174 11100732 11139573 11149920 11283351 11675395 11689437 12965207 15277523 16093310 16319894 16554755 17227760 17632063 17986448 18508918 18544538 18616809 18701704 18719252 18971623 19021777 19285500 19325107 19398890 19619494 19793921 19840948 20010802 20093466 20141839 20382112 20382742 20430885 20526336 20615880 20639194 20855502 21196517 21228276 21460040 21617041 21757540 21987634 22055191 22056771 22123825 22240591 22282571 22308029 22325599 22354992 22384331 22539722 22579291 22643220 22652539 22733735 22768199 22778255 22782902 22826123 22885598 23043107 23503366 23549786 23559066 24705553 25042851 25461810 25483965
Predicted Disordered Regions
[Dichot]
Sequence
>NP_009475.1
MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFGR