| CHP761 | |
| Library | CH (Link to library) |
| Clone ID | CHP761 (Link to dictyBase) |
| Atlas ID | - |
| NBRP ID | - |
| dictyBase ID | - |
| Link to Contig | Contig-U15639-1 |
| Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP7-C/CHP761Q.Seq.d/ |
| Representative seq. ID | (Link to Original site) |
| Representative DNA sequence | ![]() >CHP761 (CHP761Q) /CSM/CH/CHP7-C/CHP761Q.Seq.d/ |
| sequence update | 2002. 9.10 |
| Translated Amino Acid sequence | ![]() ---EKNXKLFSESNILSPVELESRQEILFEIYNKSIKMEANSLYDLVSTCGTSSLFCSSK |
| Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
| Homology vs CSM-cDNA | ![]()
|
| own update | 2002.10. 4 |
| Homology vs DNA | ![]()
|
| dna update | 2005.10.13 |
| Homology vs Protein | ![]()
|
| protein update | 2009. 5.20 |
| PSORT | ![]()
|
| 5' end seq. ID | - |
| 5' end seq. | - |
| Length of 5' end seq. | - |
| 3' end seq. ID | CHP761Z |
| 3' end seq. | ![]() >CHP761Z.Seq |
| Length of 3' end seq. | 265 |
| Connected seq. ID | - |
| Connected seq. | - |
| Length of connected seq. | - |
| Full length Seq ID | - |
| Full length Seq. | - |
| Length of full length seq. | - |