| SLB873 | |
| Library | SL (Link to library) |
| Clone ID | SLB873 (Link to dictyBase) |
| Atlas ID | - |
| NBRP ID | - |
| dictyBase ID | - |
| Link to Contig | Contig-U11142-1 |
| Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLB8-D/SLB873Q.Seq.d/ |
| Representative seq. ID | SLB873E (Link to Original site) |
| Representative DNA sequence | ![]() >SLB873 (SLB873Q) /CSM/SL/SLB8-D/SLB873Q.Seq.d/ |
| sequence update | 1998. 4.20 |
| Translated Amino Acid sequence | ![]() LGARRPSPKRLILKPQDIKRMGGVVNFTPAKFNIVGDEQSETSILTSTGSFLITWNFRKI |
| Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
| Homology vs CSM-cDNA | ![]()
|
| own update | 2002.12.11 |
| Homology vs DNA | ![]()
|
| dna update | 2009. 2.21 |
| Homology vs Protein | ![]()
|
| protein update | 2009. 7. 4 |
| PSORT | ![]()
|
| 5' end seq. ID | - |
| 5' end seq. | - |
| Length of 5' end seq. | - |
| 3' end seq. ID | - |
| 3' end seq. | - |
| Length of 3' end seq. | - |
| Connected seq. ID | - |
| Connected seq. | - |
| Length of connected seq. | - |
| Full length Seq ID | SLB873E |
| Full length Seq. | ![]() >SLB873E.Seq |
| Length of full length seq. | 374 |