SLK439 | |
Library | SL (Link to library) |
Clone ID | SLK439 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U15249-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLK4-B/SLK439Q.Seq.d/ |
Representative seq. ID | SLK439P (Link to Original site) |
Representative DNA sequence | ![]() >SLK439 (SLK439Q) /CSM/SL/SLK4-B/SLK439Q.Seq.d/ |
sequence update | 1999. 3. 8 |
Translated Amino Acid sequence | ![]() RKPQRKISKTPIKILDAPMIKDDFYLNLIDWSSHNILAVGLDTSVYLWNATTSQVSKLCE |
Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
Homology vs CSM-cDNA | ![]()
|
own update | 2009. 4. 4 |
Homology vs DNA | ![]()
|
dna update | 2003. 7.16 |
Homology vs Protein | ![]()
|
protein update | 2009. 6. 7 |
PSORT | ![]()
|
5' end seq. ID | SLK439F |
5' end seq. | ![]() >SLK439F.Seq |
Length of 5' end seq. | 261 |
3' end seq. ID | SLK439Z |
3' end seq. | ![]() >SLK439Z.Seq |
Length of 3' end seq. | 155 |
Connected seq. ID | SLK439P |
Connected seq. | ![]() >SLK439P.Seq |
Length of connected seq. | 416 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |