| SLK439 | |
| Library | SL (Link to library) |
| Clone ID | SLK439 (Link to dictyBase) |
| Atlas ID | - |
| NBRP ID | - |
| dictyBase ID | - |
| Link to Contig | Contig-U15249-1 |
| Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLK4-B/SLK439Q.Seq.d/ |
| Representative seq. ID | SLK439P (Link to Original site) |
| Representative DNA sequence | ![]() >SLK439 (SLK439Q) /CSM/SL/SLK4-B/SLK439Q.Seq.d/ |
| sequence update | 1999. 3. 8 |
| Translated Amino Acid sequence | ![]() RKPQRKISKTPIKILDAPMIKDDFYLNLIDWSSHNILAVGLDTSVYLWNATTSQVSKLCE |
| Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
| Homology vs CSM-cDNA | ![]()
|
| own update | 2009. 4. 4 |
| Homology vs DNA | ![]()
|
| dna update | 2003. 7.16 |
| Homology vs Protein | ![]()
|
| protein update | 2009. 6. 7 |
| PSORT | ![]()
|
| 5' end seq. ID | SLK439F |
| 5' end seq. | ![]() >SLK439F.Seq |
| Length of 5' end seq. | 261 |
| 3' end seq. ID | SLK439Z |
| 3' end seq. | ![]() >SLK439Z.Seq |
| Length of 3' end seq. | 155 |
| Connected seq. ID | SLK439P |
| Connected seq. | ![]() >SLK439P.Seq |
| Length of connected seq. | 416 |
| Full length Seq ID | - |
| Full length Seq. | - |
| Length of full length seq. | - |