| VFA226 | |
| Library | VF (Link to library) |
| Clone ID | VFA226 (Link to dictyBase) |
| Atlas ID | - |
| NBRP ID | - |
| dictyBase ID | - |
| Link to Contig | Contig-U15522-1 |
| Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFA2-B/VFA226Q.Seq.d/ |
| Representative seq. ID | VFA226P (Link to Original site) |
| Representative DNA sequence | ![]() >VFA226 (VFA226Q) /CSM/VF/VFA2-B/VFA226Q.Seq.d/ |
| sequence update | 2001. 6. 1 |
| Translated Amino Acid sequence | ![]() HGRKYNNNNNNNNNNVSTPPHQKPHLTTGLRTSSSGLLMDKRRQDEEKFSAEQVAMGKKS |
| Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
| Homology vs CSM-cDNA | ![]()
|
| own update | 2004.12.25 |
| Homology vs DNA | ![]()
|
| dna update | 2003. 8.15 |
| Homology vs Protein | ![]()
|
| protein update | 2009. 6.16 |
| PSORT | ![]()
|
| 5' end seq. ID | VFA226F |
| 5' end seq. | ![]() >VFA226F.Seq |
| Length of 5' end seq. | 605 |
| 3' end seq. ID | VFA226Z |
| 3' end seq. | ![]() >VFA226Z.Seq |
| Length of 3' end seq. | 570 |
| Connected seq. ID | VFA226P |
| Connected seq. | ![]() >VFA226P.Seq |
| Length of connected seq. | 1175 |
| Full length Seq ID | - |
| Full length Seq. | - |
| Length of full length seq. | - |