VFL723 | |
Library | VF (Link to library) |
Clone ID | VFL723 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U12230-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFL7-A/VFL723Q.Seq.d/ |
Representative seq. ID | VFL723P (Link to Original site) |
Representative DNA sequence | ![]() >VFL723 (VFL723Q) /CSM/VF/VFL7-A/VFL723Q.Seq.d/ |
sequence update | 2001.11.22 |
Translated Amino Acid sequence | ![]() hcwpkfyffkisilkfkilfnkr*IYIFVFIIYLFINLNSINKMGKDYTFIRNWISFHFM |
Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
Homology vs CSM-cDNA | ![]()
|
own update | 2009. 4. 4 |
Homology vs DNA | ![]()
|
dna update | 2009. 3.24 |
Homology vs Protein | ![]()
|
protein update | 2009. 6.23 |
PSORT | ![]()
|
5' end seq. ID | VFL723F |
5' end seq. | ![]() >VFL723F.Seq |
Length of 5' end seq. | 587 |
3' end seq. ID | VFL723Z |
3' end seq. | ![]() >VFL723Z.Seq |
Length of 3' end seq. | 693 |
Connected seq. ID | VFL723P |
Connected seq. | ![]() >VFL723P.Seq |
Length of connected seq. | 1260 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |