VFO147 | |
Library | VF (Link to library) |
Clone ID | VFO147 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16449-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFO1-B/VFO147Q.Seq.d/ |
Representative seq. ID | VFO147P (Link to Original site) |
Representative DNA sequence | ![]() >VFO147 (VFO147Q) /CSM/VF/VFO1-B/VFO147Q.Seq.d/ |
sequence update | 2001.11.22 |
Translated Amino Acid sequence | ![]() ifsvcieikvl*YKMSKTPAKLVDCSSTLSRVGNHLQMGVVGMPNVGKSSLFNLLCKMSI |
Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
Homology vs CSM-cDNA | ![]()
|
own update | 2004.12.24 |
Homology vs DNA | ![]()
|
dna update | 2009. 5.15 |
Homology vs Protein | ![]()
|
protein update | 2009. 6.25 |
PSORT | ![]()
|
5' end seq. ID | VFO147F |
5' end seq. | ![]() >VFO147F.Seq |
Length of 5' end seq. | 484 |
3' end seq. ID | VFO147Z |
3' end seq. | ![]() >VFO147Z.Seq |
Length of 3' end seq. | 786 |
Connected seq. ID | VFO147P |
Connected seq. | ![]() >VFO147P.Seq |
Length of connected seq. | 1250 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |