| VFO147 | |
| Library | VF (Link to library) |
| Clone ID | VFO147 (Link to dictyBase) |
| Atlas ID | - |
| NBRP ID | - |
| dictyBase ID | - |
| Link to Contig | Contig-U16449-1 |
| Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFO1-B/VFO147Q.Seq.d/ |
| Representative seq. ID | VFO147P (Link to Original site) |
| Representative DNA sequence | ![]() >VFO147 (VFO147Q) /CSM/VF/VFO1-B/VFO147Q.Seq.d/ |
| sequence update | 2001.11.22 |
| Translated Amino Acid sequence | ![]() ifsvcieikvl*YKMSKTPAKLVDCSSTLSRVGNHLQMGVVGMPNVGKSSLFNLLCKMSI |
| Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
| Homology vs CSM-cDNA | ![]()
|
| own update | 2004.12.24 |
| Homology vs DNA | ![]()
|
| dna update | 2009. 5.15 |
| Homology vs Protein | ![]()
|
| protein update | 2009. 6.25 |
| PSORT | ![]()
|
| 5' end seq. ID | VFO147F |
| 5' end seq. | ![]() >VFO147F.Seq |
| Length of 5' end seq. | 484 |
| 3' end seq. ID | VFO147Z |
| 3' end seq. | ![]() >VFO147Z.Seq |
| Length of 3' end seq. | 786 |
| Connected seq. ID | VFO147P |
| Connected seq. | ![]() >VFO147P.Seq |
| Length of connected seq. | 1250 |
| Full length Seq ID | - |
| Full length Seq. | - |
| Length of full length seq. | - |