| VSA218 | |
| Library | VS (Link to library) |
| Clone ID | VSA218 (Link to dictyBase) |
| Atlas ID | - |
| NBRP ID | - |
| dictyBase ID | - |
| Link to Contig | Contig-U10472-1 |
| Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSA2-A/VSA218Q.Seq.d/ |
| Representative seq. ID | VSA218Z (Link to Original site) |
| Representative DNA sequence | ![]() >VSA218 (VSA218Q) /CSM/VS/VSA2-A/VSA218Q.Seq.d/ |
| sequence update | 2000. 2.14 |
| Translated Amino Acid sequence | ![]() ---VFGVISVIRNALPHLRINKFFANGPRIINISSIAGFTGSFPGFSIYSSTKFALEGLT |
| Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
| Homology vs CSM-cDNA | ![]()
|
| own update | 2004.12.25 |
| Homology vs DNA | ![]()
|
| dna update | 2003. 8.18 |
| Homology vs Protein | ![]()
|
| protein update | 2009. 7.22 |
| PSORT | ![]()
|
| 5' end seq. ID | - |
| 5' end seq. | - |
| Length of 5' end seq. | - |
| 3' end seq. ID | VSA218Z |
| 3' end seq. | ![]() >VSA218Z.Seq |
| Length of 3' end seq. | 578 |
| Connected seq. ID | - |
| Connected seq. | - |
| Length of connected seq. | - |
| Full length Seq ID | - |
| Full length Seq. | - |
| Length of full length seq. | - |