| 1BV2 | |
| PDB ID | 1BV2 |
| Japanese name | イネ |
| English name | Rice |
| Scientific name | Oryza sativa L. |
| Protein name | Nonspecific Lipid-Transfer Protein 1 Precursor |
| Gene name | - |
| Source/Organism | Oryza Sativa |
| Compound | Molecule: Nonspecific Lipid Transfer Protein; Chain: Null |
| Classification | Lipid-Binding Protein |
| EC number | - |
| Authors | J.Poznanski, P.Sodano, S.W.Suh, J.Y.Lee, M.Ptak, F.Vovelle |
| Reference | J.Poznanski, P.Sodano, S.W.Suh, J.Y.Lee, M.Ptak, F.Vovelle Solution Structure Of A Lipid Transfer Protein Extracted From Rice Seeds. Comparison With Homologous Proteins Eur.J.Biochem. V. 259 692 1999 |
| Key word | Lipid-Binding Protein, Lipid Transfer Protein, Rice, Molecular Modeling, Nmr |
| Cross reference | SWS:NLT1_ORYSA,P23096 EMBL; U77295; AAB18815.1; -. EMBL; Y08691; CAA69949.1; -. PIR; T03781; T03781. PDB; 1BV2; NMR; @=26-116. PDB; 1RZL; X-ray; @=26-116. Gramene; P23096; -. InterPro; IPR003612; AAI. InterPro; IPR000528; Plant_LTP. Pfam; PF00234; Tryp_alpha_amyl; 1. PRINTS; PR00382; LIPIDTRNSFER. SMART; SM00499; AAI; 1. PROSITE; PS00597; PLANT_LTP; 1. |
| Experimental method | Nmr, 14 Structures |
| Sequence characteristics | Length: 116 AA, Molecular weight: 11364 Da |
| Sequence | MARAQLVLVALVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLF AAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS |
| Image |  |