| 1FI2 | |
| PDB ID | 1FI2 |
| Japanese name | 大麦 |
| English name | Barley |
| Scientific name | Hordeum vulgare l. |
| Protein name | Oxalate Oxidase 1 |
| Gene name | - |
| Source/Organism | Hordeum Vulgare |
| Compound | Molecule: Oxalate Oxidase; Chain: A; Synonym: Germin; |
| Classification | Oxidoreductase |
| EC number | 1.2.3.4 (Oxalate Oxidase) |
| Authors | E.J.Woo, J.M.Dunwell, P.W.Goodenough, A.C.Marvier, R.W.Pickersgill |
| Reference | E.J.Woo, J.M.Dunwell, P.W.Goodenough, A.C.Marvier, R.W.Pickersgill Germin Is A Manganese Containing Homohexamer With Oxalate Oxidase And Superoxide Dismutase Activities Nat.Struct.Biol. V. 7 1036 2000 |
| Key word | Beta-Jellyroll |
| Cross reference | SWS:OXO1_HORVU,P45850 EMBL; L15737; AAA32959.1; -. PIR; A45980; A45980. PDB; 1FI2; X-ray; A=1-201. InterPro; IPR006045; Cupin. InterPro; IPR007113; Cupin_region. InterPro; IPR001929; Germin. InterPro; IPR011051; RmlC_like_cupin. Pfam; PF00190; Cupin; 1. PRINTS; PR00325; GERMIN. PROSITE; PS00725; GERMIN; 1. |
| Experimental method | X-Ray Diffraction, Resolution: 1.60 Angstrom, R-Factor: 0.196, R-Free: 0.233 |
| Sequence characteristics | Length: 201 AA, Molecular weight: 21203 Da |
| Sequence | SDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELD VAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYS RVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLT KALRVEAGVVELLKSKFAGGS |
| Image |  |