| 1GPT | |
| PDB ID | 1GPT |
| Japanese name | 大麦 |
| English name | Barley |
| Scientific name | Hordeum vulgare l. |
| Protein name | Gamma Hordothionin. |
| Gene name | - |
| Source/Organism | Hordeum Vulgare |
| Compound | Gamma-1-H Thionin (Nmr, 8 Structures) |
| Classification | Plant Toxin |
| EC number | - |
| Authors | M.Bruix, M.A.Jimenez, J.Santoro, C.Gonzalez, F.J.Colilla, E.Mendez, M.Rico |
| Reference | M.Bruix, M.A.Jimenez, J.Santoro, C.Gonzalez, F.J.Colilla, E.Mendez, M.Rico Solution Structure Of Gamma 1-H And Gamma 1-P Thionins From Barley And Wheat Endosperm Determined By ==1==H-Nmr: A Structural Motif Common To Toxic Arthropod Proteins Biochemistry V. 32 715 1993 |
| Key word | - |
| Cross reference | PIR; S13849; S13849. PDB; 1GPT; NMR; @=1-47. InterPro; IPR008176; Gamma-thionin. InterPro; IPR008177; G_Purothionin. InterPro; IPR003614; Knot1. Pfam; PF00304; Gamma-thionin; 1. PRINTS; PR00288; PUROTHIONIN. ProDom; PD002594; G_Purothionin; 1. SMART; SM00505; Knot1; 1. PROSITE; PS00940; GAMMA_THIONIN; 1. |
| Experimental method | Nmr |
| Sequence characteristics | Length: 47 AA, Molecular weight: 5250 Da |
| Sequence | RICRRRSAGFKGPCVSNKNCAQVCMQEGWGGGNCDGPLRRCKCMRRC |
| Image |  |