| 1JTB | |
| PDB ID | 1JTB |
| Japanese name | 大麦 |
| English name | Barley |
| Scientific name | Hordeum vulgare l. |
| Protein name | Nonspecific Lipid-Transfer Protein 1 Precursor |
| Gene name | Name=Ltp1; Synonyms=Papi; |
| Source/Organism | Hordeum Vulgare |
| Compound | Molecule: Lipid Transfer Protein; Chain: Null; Synonym: Ltp |
| Classification | Lipid Transport |
| EC number | - |
| Authors | M.H.Lerche, B.B.Kragelund, L.M.Bech, F.M.Poulsen |
| Reference | M.H.Lerche, B.B.Kragelund, L.M.Bech, F.M.Poulsen Barley Lipid-Transfer Protein Complexed With Palmitoyl Coa: The Structure Reveals A Hydrophobic Binding Site That Can Expand To Fit Both Large And Small Lipid-Like Ligands Structure (London) V. 5 291 1997 |
| Key word | Lipid Transport, Lipid Transfer Protein |
| Cross reference | SWS:NLT1_HORVU,P07597 EMBL; M15207; AAA32970.1; -. EMBL; X05168; CAA28805.1; -. EMBL; X59253; CAA41946.1; -. EMBL; X60292; CAA42832.1; ALT_SEQ. PIR; S20507; S20507. PIR; T05947; T05947. PDB; 1BE2; NMR; @=27-117. PDB; 1JTB; NMR; @=27-117. PDB; 1LIP; NMR; @=27-117. InterPro; IPR003612; AAI. InterPro; IPR000528; Plant_LTP. Pfam; PF00234; Tryp_alpha_amyl; 1. PRINTS; PR00382; LIPIDTRNSFER. SMART; SM00499; AAI; 1. PROSITE; PS00597; PLANT_LTP; 1. |
| Experimental method | Nmr, 16 Structures |
| Sequence characteristics | Length: 117 AA, Molecular weight: 12301 Da |
| Sequence | MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDL HNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRIY |
| Image |  |