| 2SNI | |
| PDB ID | 2SNI |
| Japanese name | 大麦 |
| English name | Barley |
| Scientific name | Hordeum vulgare l. |
| Protein name | Subtilisin-Chymotrypsin Inhibitor-2a |
| Gene name | - |
| Source/Organism | Hordeum Vulgare |
| Compound | Subtilisin Novo (E.C.3.4.21.14) Complex With Chymotrypsin Inhibitor 2 (/Ci$-2) |
| Classification | Complex (Proteinase/Inhibitor) |
| EC number | - |
| Authors | C.A.Mc*Phalen, M.N.G.James |
| Reference | C.A.Mc*Phalen, M.N.G.James Structural Comparison Of Two Serine 2snia 2 Proteinase-*Protein Inhibitor Complexes. 2snia 3eglin-*C-*Subtilisin Carlsberg And 2snia 4/Ci$-2-*Subtilisin Novo 2snia 5biochemistry V. 27 6582 1988 2snia 6 |
| Key word | - |
| Cross reference | EMBL; X05404; CAA28988.1; -. PIR; A01292; EIBH2A. PDB; 1CIQ; X-ray; A=20-59, B=60-83. PDB; 1CIR; NMR; A=20-59, B=60-83. PDB; 1COA; X-ray; I=20-83. PDB; 1CQ4; X-ray; A=20-66, B=60-83. PDB; 1LW6; X-ray; I=20-83. PDB; 1YPA; X-ray; I=20-83. PDB; 1YPB; X-ray; I=20-83. PDB; 1YPC; X-ray; I=20-83. PDB; 2CI2; X-ray; I=1-83. PDB; 2SNI; X-ray; I=1-83. PDB; 3CI2; NMR; @=18-83. InterPro; IPR000864; Prot_inh_pot1. Pfam; PF00280; potato_inhibit; 1. PRINTS; PR00292; POTATOINHBTR. ProDom; PD002604; Prot_inh_pot1; 1. PROSITE; PS00285; POTATO_INHIBITOR; 1. |
| Experimental method | - |
| Sequence characteristics | Length: 83 AA, Molecular weight: 9250 Da |
| Sequence | SSVEKKPEGVNTGAGDRHNLKTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVTME YRIDRVRLFVDKLDNIAQVPRVG |
| Image |  |