3CI2 | |
PDB ID | 3CI2 |
Japanese name | 大麦 |
English name | Barley |
Scientific name | Hordeum vulgare l. |
Protein name | Subtilisin-Chymotrypsin Inhibitor-2a |
Gene name | - |
Source/Organism | Hordeum Vulgare |
Compound | Chymotrypsin Inhibitor 2 (Serine Proteinase Inhibitor 2) (Nmr, 20 Structures) |
Classification | Serine Protease Inhibitor |
EC number | - |
Authors | F.M.Poulsen |
Reference | S.Ludvigsen, H.Shen, M.Kjaer, J.C.Madsen, F.M.Poulsen Refinement Of The Three-Dimensional Solution Structure Of Barley Serine Proteinase Inhibitor 2 And Comparison With The Structures In Crystals J.Mol.Biol. V. 222 621 1991 |
Key word | - |
Cross reference | EMBL; X05404; CAA28988.1; -. PIR; A01292; EIBH2A. PDB; 1CIQ; X-ray; A=20-59, B=60-83. PDB; 1CIR; NMR; A=20-59, B=60-83. PDB; 1COA; X-ray; I=20-83. PDB; 1CQ4; X-ray; A=20-66, B=60-83. PDB; 1LW6; X-ray; I=20-83. PDB; 1YPA; X-ray; I=20-83. PDB; 1YPB; X-ray; I=20-83. PDB; 1YPC; X-ray; I=20-83. PDB; 2CI2; X-ray; I=1-83. PDB; 2SNI; X-ray; I=1-83. PDB; 3CI2; NMR; @=18-83. InterPro; IPR000864; Prot_inh_pot1. Pfam; PF00280; potato_inhibit; 1. PRINTS; PR00292; POTATOINHBTR. ProDom; PD002604; Prot_inh_pot1; 1. PROSITE; PS00285; POTATO_INHIBITOR; 1. |
Experimental method | Nmr |
Sequence characteristics | Length: 83 AA, Molecular weight: 9250 Da |
Sequence | SSVEKKPEGVNTGAGDRHNLKTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVTME YRIDRVRLFVDKLDNIAQVPRVG |
Image |