| 1CZ2 | |
| PDB ID | 1CZ2 |
| Japanese name | 小麦 |
| English name | Bread Wheat |
| Scientific name | Triticum aestivum |
| Protein name | Nonspecific Lipid-Transfer Protein Precursor |
| Gene name | - |
| Source/Organism | Triticum Aestivum |
| Compound | Molecule: Nonspecific Lipid Transfer Protein; Chain: A |
| Classification | Lipid Binding Protein |
| EC number | - |
| Authors | S.Tassin-Moindrot, A.Caille, J.-P.Douliez, D.Marion, F.Vovelle |
| Reference | S.Tassin-Moindrot, A.Caille, J.-P.Douliez, D.Marion, F.Vovelle The Wide Binding Properties Of A Wheat Nonspecific Lipid Transfer Protein. Solution Structure Of A Complex With Prostaglandin B2 Eur.J.Biochem. V. 267 1117 2000 |
| Key word | Protein Complex Alpha Helix |
| Cross reference | SWS:NLTA_WHEAT,P24296 EMBL; X63669; CAA45210.1; -. PDB; 1BWO; X-ray; A/B=24-112. PDB; 1CZ2; NMR; A=24-112. PDB; 1GH1; NMR; A=24-112. InterPro; IPR003612; AAI. InterPro; IPR000528; Plant_LTP. Pfam; PF00234; Tryp_alpha_amyl; 1. PRINTS; PR00382; LIPIDTRNSFER. SMART; SM00499; AAI; 1. PROSITE; PS00597; PLANT_LTP; 1. |
| Experimental method | Nmr, 12 Structures |
| Sequence characteristics | Length: 113 AA, Molecular weight: 11899 Da |
| Sequence | AQVMLMAVALVLMLAAVPRAAVAIDCGHVDSLVRPCLSYVQGGPGPSGQCCDGVKNLHNQ ARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV |
| Image |  |