1HSS | |
PDB ID | 1HSS |
Japanese name | 小麦 |
English name | Bread Wheat |
Scientific name | Triticum aestivum |
Protein name | Alpha-Amylase Inhibitor 0.19 |
Gene name | - |
Source/Organism | Triticum Aestivum |
Compound | Molecule: 0.19 Alpha-Amylase Inhibitor; Chain: A, B, C, D; Biological_unit: Dimer |
Classification | Cereal Inhibitor |
EC number | - |
Authors | Y.Oda, K.Fukuyama |
Reference | Y.Oda, T.Matsunaga, K.Fukuyama, T.Miyazaki, T.Morimoto Tertiary And Quaternary Structures Of 0.19 Alpha-Amylase Inhibitor From Wheat Kernel Determined By X-Ray Analysis At 2.06 A Resolution Biochemistry V. 36 13503 1997 |
Key word | Cereal Inhibitor, Animal Amylase |
Cross reference | SWS:IAA1_WHEAT,P01085 EMBL; AB003682; BAA20139.1; -. PIR; A01324; WIWTA1. PDB; 1HSS; X-ray; A/B/C/D=1-124. InterPro; IPR003612; AAI. InterPro; IPR006106; Cereal_allergen. InterPro; IPR006105; Try/amyl_inhib. Pfam; PF00234; Tryp_alpha_amyl; 1. PRINTS; PR00808; AMLASEINHBTR. SMART; SM00499; AAI; 1. PROSITE; PS00426; CEREAL_TRYP_AMYL_INH; 1. |
Experimental method | X-Ray Diffraction, Resolution: 2.06 Angstrom, R-Factor: 0.187, R-Free: 0.223 |
Sequence characteristics | Length: 124 AA, Molecular weight: 13337 Da |
Sequence | SGPWMCYPGQAFQVPALPACRPLLRLQCNGSQVPEAVLRDCCQQLAHISEWCRCGALYSM LDSMYKEHGAQEGQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDASGDGAYVCKDVAA YPDA |
Image |