1UVB | |
PDB ID | 1UVB |
Japanese name | イネ |
English name | Rice |
Scientific name | Oryza sativa L. |
Protein name | Nonspecific Lipid-Transfer Protein 1 Precursor |
Gene name | - |
Source/Organism | Oryza Sativa |
Compound | Molecule: Nonspecific Lipid Transfer Protein; Synonym: Ltp 1, Pap 1; Chain: A; Other_details: Complexed With Palmitic Acid |
Classification | Lipid Transport |
EC number | - |
Authors | H.-C.Cheng, P.-T.Cheng, P.Peng, P.-C.Lyu, Y.-J.Sun |
Reference | H.-C.Cheng, P.-T.Cheng, P.-C.P.Plyu, Y.-J.Sun Lipid Binding In Rice Nonspecific Lipid Transfer Protein-1 Complexes From Oryza Sativa To Be Published |
Key word | Lipid Transport, Ltp 1, Pap 1, Rice, Fatty Acid Binding |
Cross reference | UNP:NLT1_ORYSA,P23096 EMBL; U77295; AAB18815.1; -. EMBL; Y08691; CAA69949.1; -. PIR; T03781; T03781. PDB; 1BV2; NMR; @=26-116. PDB; 1RZL; X-ray; @=26-116. Gramene; P23096; -. InterPro; IPR003612; AAI. InterPro; IPR000528; Plant_LTP. Pfam; PF00234; Tryp_alpha_amyl; 1. PRINTS; PR00382; LIPIDTRNSFER. SMART; SM00499; AAI; 1. PROSITE; PS00597; PLANT_LTP; 1. |
Experimental method | X-Ray Diffraction, Resolution: 2.1 Angstrom, R-Factor: 0.224, R-Free: 0.265 |
Sequence characteristics | Length: 116 AA, Molecular weight: 11364 Da |
Sequence | MARAQLVLVALVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLF AAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS |
Image |