| 2PLH | |
| PDB ID | 2PLH |
| Japanese name | 小麦 |
| English name | Bread Wheat |
| Scientific name | Triticum aestivum |
| Protein name | Alpha-1-Purothionin Precursor |
| Gene name | Name=Thi1.1; Synonyms=Pur-D1; |
| Source/Organism | Triticum Aestivum |
| Compound | Molecule: Alpha-1-Purothionin; 2plh 6 Chain: Null; 2plh 7 Other_details: Solute Molecules Not Added To The 2plh 8 Crystallization\: Phosphate, Acetate, Glycerol 2plh 9 |
| Classification | Toxin |
| EC number | - |
| Authors | M.M.Teeter, B.Stec, U.Rao 2plh 16 |
| Reference | U.Rao, B.Stec, M.M.Teeter 2plh 18 Refinement Of Purothioneins Reveals Solute 2plh 19 Particles Important For Lattice Formation And 2plh 20toxicity. Part 1. Alpha=1=-Purothionin Revisited 2plh 21acta Crystallogr., Sect.D V. 51 904 1995 2plh 22 |
| Key word | Membrane Active, Disulfide Rich 2plh 14 |
| Cross reference | THN1_WHEAT:61,17 EMBL; X70666; CAA50004.1; -. PDB; 2PLH; X-ray; @=17-60. InterPro; IPR001010; Thionin. Pfam; PF00321; Thionin; 1. PRINTS; PR00287; THIONIN. PROSITE; PS00271; THIONIN; 1. |
| Experimental method | X-Ray Diffraction 2plh 15 |
| Sequence characteristics | Length: 126 AA, Molecular weight: 13525 Da |
| Sequence | CLLILGLVLEQLQVEGKSCCRSTLGRNCYNLCRARGAQKLCAGVCRCKISSGLSCPKGFP KLALESNSDEPDTIEYCNLGCRSSVCDYMVNAAADDEEMKLYVENCADACVSFCNGDAGL PSLDAY |
| Image |  |