1JH7 | |
PDB ID | 1JH7 |
Japanese name | シロイヌナズナ |
English name | Arabidopsis |
Scientific name | Arabidopsis thaliana (L.) Heynh. |
Protein name | Cyclic Phosphodiesterase |
Gene name | Orderedlocusnames=At4g18930; Orfnames=F13c5.100, F13c5_100; |
Source/Organism | Arabidopsis Thaliana |
Compound | Molecule: Cyclic Phosphodiesterase; Chain: A; Engineered: Yes |
Classification | Hydrolase |
EC number | 3.1.4.- (Cyclic Phosphodiesterase) |
Authors | A.Hofmann, M.Grella, I.Botos, W.Filipowicz, A.Wlodawer |
Reference | A.Hofmann, M.Grella, I.Botos, W.Filipowicz, A.Wlodawer Crystal Structures Of The Semireduced And Inhibitor-Bound Forms Of Cyclic Nucleotide Phosphodiesterase From Arabidopsis Thaliana J.Biol.Chem. V. 277 1419 2002 |
Key word | Adp-Ribose 1'',2''-Cyclic Phosphate, Rna Processing, 2',3'-Cyclic Nucleotide Phosphodiesterase, 2',3'-Cyclic Uridine Vanadate |
Cross reference | GB:CAA72363,2065013 EMBL; Y11650; CAA72363.1; -. EMBL; AL021711; CAA16750.1; -. EMBL; AL161549; CAB78895.1; -. EMBL; AY062822; AAL32900.1; -. EMBL; AY081630; AAM10192.1; -. PIR; T05030; T05030. PDB; 1FSI; X-ray; A/B/C=1-181. PDB; 1JH6; X-ray; A/B=1-181. PDB; 1JH7; X-ray; A=1-181. InterPro; IPR009097; Cyc_nuc_Pdiester. |
Experimental method | X-Ray Diffraction, Resolution: 2.40 Angstrom, R-Factor: 0.214, R-Free: 0.399 |
Sequence characteristics | Length: 181 AA, Molecular weight: 20514 Da |
Sequence | MEEVKKDVYSVWALPDEESEPRFKKLMEALRSEFTGPRFVPHVTVAVSAYLTADEAKKMF ESACDGLKAYTATVDRVSTGTFFFQCVFLLLQTTPEVMEAGEHCKNHFNCSTTTPYMPHL SLLYAELTEEEKKNAQEKAYTLDSSLDGLSFRLNRLALCKTDTEDKTLETWETVAVCNLN P |
Image |