| 1OGP | |
| PDB ID | 1OGP |
| Japanese name | シロイヌナズナ |
| English name | Arabidopsis |
| Scientific name | Arabidopsis thaliana (L.) Heynh. |
| Protein name | Sulfite Oxidase |
| Gene name | Name=F1c9.31; Synonyms=At3g01910, Atmcp, F28j7.38; |
| Source/Organism | Arabidopsis Thaliana |
| Compound | Molecule: Sulfite Oxidase; Synonym: Sox, Moco Containing Protein; Chain: A, B, C, D, E, F; Engineered: Yes; Other_details: One Molybdenumn Cofactor In Each Molecule |
| Classification | Oxidoreductase |
| EC number | 1.8.3.1 (Sulfite Oxidase) |
| Authors | N.Schrader, K.Fischer, K.Theis, R.R.Mendel, G.Schwarz, C.Kisker |
| Reference | N.Schrader, K.Fischer, K.Theis, R.Mendel, G.Schwarz, C.Kisker The Crystal Structure Of Plant Sulfite Oxidase Provides Insights Into Sulfite Oxidation In Plants And Animals Structure V. 11 1251 2003 |
| Key word | Molybdenum Cofactor, Molybdopterin, Plant Sulfite Oxidase, Peroxisomes, Intramolecular Electron Transfer,Oxidoreductase |
| Cross reference | SWS:Q9S850,Q9S850 EMBL; AC011664; AAF14844.1; -. EMBL; AB071965; BAC10904.1; -. EMBL; AC010797; AAF03458.1; -. EMBL; AY133863; AAM91797.1; -. EMBL; AF360247; AAK25957.1; -. PDB; 1OGP; X-ray; A/B/C/D/E/F=1-393. GO; GO:0016491; F:oxidoreductase activity; IEA. GO; GO:0006118; P:electron transport; IEA. InterPro; IPR008335; Euk_Mb_oxred. InterPro; IPR005066; Mo-co_dimer. InterPro; IPR000572; Oxidored_molyb. Pfam; PF03404; Mo-co_dimer; 1. Pfam; PF00174; Oxidored_molyb; 1. PRINTS; PR00407; EUMOPTERIN. |
| Experimental method | X-Ray Diffraction, Resolution: 2.60 Angstrom, R-Factor: 0.23522, R-Free: 0.26617 |
| Sequence characteristics | Length: 393 AA, Molecular weight: 43329 Da |
| Sequence | MPGIRGPSEYSQEPPRHPSLKVNAKEPFNAEPPRSALVSSYVTPVDLFYKRNHGPIPIVD HLQSYSVTLTGLIQNPRKLFIKDIRSLPKYNVTATLQCAGNRRTAMSKVRNVRGVGWDVS AIGNAVWGGAKLADVLELVGIPKLTASTNLGARHVEFVSVDRCKEENGGPYKASITLSQA TNPEADVLLAYEMNGETLNRDHGFPLRVVVPGVIGARSVKWLDSINVIAEESQGFFMQKD YKMFPPSVNWDNINWSSRRPQMDFPVQSAICSVEDVQMVKPGKVSIKGYAVSGGGRGIER VDISLDGGKNWVEASRTQEPGKQYISEHSSSDKWAWVLFEATIDVSQTTEVIAKAVDSAA NVQPENVESVWNLRGVLNTSWHRVLLRLGHSNL |
| Image |  |