| 1AW9 | |
| PDB ID | 1AW9 |
| Japanese name | トウモロコシ |
| English name | Corn |
| Scientific name | Zea mays L. |
| Protein name | Glutathione Transferase Iii |
| Gene name | Name=Gst3a; |
| Source/Organism | Zea Mays |
| Compound | Molecule: Glutathione S-Transferase Iii; Chain: Null; Engineered: Yes; Biological_unit: Homodimer; Other_details: Apo Form |
| Classification | Transferase |
| EC number | 2.5.1.18 (Glutathione S-Transferase Iii) |
| Authors | T.Neuefeind, R.Huber, P.Reinemer, J.Knaeblein, |
| Reference | T.Neuefeind, R.Huber, P.Reinemer, J.Knablein, L.Prade, K.Mann, B.Bieseler Cloning, Sequencing, Crystallization And X-Ray Structure Of Glutathione S-Transferase-Iii From Zea Mays Var. Mutin: A Leading Enzyme In Detoxification Of Maize Herbicides J.Mol.Biol. V. 274 577 1997 |
| Key word | Transferase, Herbicide Detoxification |
| Cross reference | PDB:1AW9,1AW9 EMBL; AJ010295; CAB38118.1; -. PIR; T52084; T52084. PDB; 1AW9; X-ray; @=2-217. GO; GO:0004364; F:glutathione transferase activity; IEA. GO; GO:0016740; F:transferase activity; IEA. InterPro; IPR004046; GST_Cterm. InterPro; IPR010987; GST_C_like. InterPro; IPR004045; GST_Nterm. Pfam; PF00043; GST_C; 1. Pfam; PF02798; GST_N; 1. |
| Experimental method | X-Ray Diffraction, Resolution: 2.2 Angstrom, R-Factor: 0.197, R-Free: Null |
| Sequence characteristics | Length: 221 AA, Molecular weight: 23924 Da |
| Sequence | MAPLKLYGMPLSPNVVRVATVLNEKGLDFEIVPVDLTTGAHKQPDFLTLNPFGQIPALVD GDEVLFESRAINRYIASKYASEGTDLLPATASAAKLEVWLEVESHHFYPNASPLVFQLLV RPLLGGAPDAAVVDKHAEQLAKVLDVYEAHLARNKYLAGDEFTLADANHASYLLYLSKTP KAGLVAARPHVKAWWEAIVARPAFQKTVAAIPLPPPPSSSA |
| Image |  |