| 1TIZ | |
| PDB ID | 1TIZ |
| Japanese name | シロイヌナズナ |
| English name | Arabidopsis |
| Scientific name | Arabidopsis thaliana (L.) Heynh. |
| Protein name | Calmodulin-Like Protein. |
| Gene name | Name=T21p5.17; |
| Source/Organism | Arabidopsis Thaliana |
| Compound | Molecule: Calmodulin-Related Protein, Putative; Chain: A; Fragment: N-Terminal Domain; Engineered: Yes |
| Classification | Calcium-Binding Protein |
| EC number | - |
| Authors | J.Song, Q.Zhao, S.Thao, R.O.Frederick, J.L.Markley, Center For Eukaryotic Structural Genomics (Cesg) |
| Reference | J.Song, Q.Zhao, S.Thao, R.O.Frederick, J.L.Markley Letter To The Editor: Solution Structure Of A Calmodulin-Like Calcium-Binding Domain From Arabidopsis Thaliana J.Biomol.Nmr V. 30 451 2004 |
| Key word | Helix-Turn-Helix, Structural Genomics, Psi, Protein Structure Initiative, Center For Eukaryotic Structural Genomics, Cesg |
| Cross reference | GB:NP_186991,15228547 EMBL; AC009895; AAF01604.1; -. PDB; 1TIZ; NMR; A=-. GO; GO:0005509; F:calcium ion binding; IEA. InterPro; IPR002048; EF-hand. InterPro; IPR010983; EF_Hand_like. Pfam; PF00036; efhand; 4. ProDom; PD000012; EF-hand; 2. SMART; SM00054; EFh; 4. PROSITE; PS00018; EF_HAND; UNKNOWN_3. |
| Experimental method | Nmr, 20 Structures |
| Sequence characteristics | Length: 131 AA, Molecular weight: 14731 Da |
| Sequence | MSAKRVFEKFDKNKDGKLSLDEFREVALAFSPYFTQEDIVKFFEEIDVDGNGELNADEFT SCIEKMLKEVFVFCDVDGDGKIPASESYVTMTSLGKKFTEETSAEKVRAADVDGDGYLNF DEFMALVIGDI |
| Image |  |