| 1TQ1 | |
| PDB ID | 1TQ1 |
| Japanese name | シロイヌナズナ |
| English name | Arabidopsis |
| Scientific name | Arabidopsis thaliana (L.) Heynh. |
| Protein name | Senescence-Associated Protein |
| Gene name | - |
| Source/Organism | Arabidopsis Thaliana |
| Compound | Molecule: Senescence-Associated Family Protein; Chain: A; Synonym: At5g66040; Engineered: Yes |
| Classification | Structural Genomics, Unknown Function |
| EC number | - |
| Authors | C.C.Cornilescu, G.Cornilescu, S.Singh, M.S.Lee, E.M.Tyler, M.N.Shahan, D.Vinarov, J.L.Markley, Center For Eukaryotic Structural Genomics (Cesg) |
| Reference | C.C.Cornilescu, G.Cornilescu, S.Singh, M.S.Lee, E.M.Tyler, M.N.Shahan, D.Vinarov, J.L.Markley Solution Structure Of At5g66040, A Putative Protein From Arabidosis Thaliana To Be Published |
| Key word | At5g66040, Cesg, Structural Genomics, Psi, Protein Structure Initiative, Center For Eukaryotic Structural Genomics |
| Cross reference | GB:NP_851278,30698182 EMBL; AB011474; BAB10409.1; -. EMBL; AY049302; AAK83644.1; -. EMBL; AY084763; AAM61332.1; -. EMBL; BT000864; AAN38701.1; -. PDB; 1TQ1; NMR; A=-. InterPro; IPR001763; Rhodanese-like. Pfam; PF00581; Rhodanese; 1. SMART; SM00450; RHOD; 1. PROSITE; PS50206; RHODANESE_3; 1. |
| Experimental method | Nmr, 5 Structures |
| Sequence characteristics | Length: 120 AA, Molecular weight: 12676 Da |
| Sequence | MAEESRVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGMSKNP DFLEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTKA |
| Image |  |