| 1WJJ | |
| PDB ID | 1WJJ |
| Japanese name | シロイヌナズナ |
| English name | Arabidopsis |
| Scientific name | Arabidopsis thaliana (L.) Heynh. |
| Protein name | Hypothetical Protein F20o9.120 |
| Gene name | Name=F20o9.120; Synonyms=At4g28440, At4g28440; |
| Source/Organism | Arabidopsis Thaliana |
| Compound | Molecule: Hypothetical Protein F20o9.120; Chain: A; Fragment: Residues 14-145; Engineered: Yes |
| Classification | Structural Genomics, Unknown Function |
| EC number | - |
| Authors | M.Sato, T.Tomizawa, S.Koshiba, M.Inoue, T.Kigawa, S.Yokoyama |
| Reference | M.Sato, T.Tomizawa, S.Koshiba, M.Inoue, T.Kigawa, S.Yokoyama Solution Structure Of Hypothetical Protein F20o9.120 From Arabidopsis Thaliana To Be Published |
| Key word | Hypothetical Protein, Dna-Binding Protein-Related, Structural Genomics |
| Cross reference | GB:AAK93582,15292943 EMBL; AL021749; CAA16883.1; -. EMBL; AY050905; AAK93582.1; -. EMBL; AY056432; AAL08288.1; -. EMBL; AY088082; AAM65628.1; -. EMBL; AY091407; AAM14346.1; -. EMBL; AL161572; CAB79646.1; -. PIR; T04614; T04614. GO; GO:0003676; F:nucleic acid binding; IEA. InterPro; IPR008994; Nucleic_acid_OB. |
| Experimental method | Nmr, 20 Structures |
| Sequence characteristics | Length: 153 AA, Molecular weight: 16459 Da |
| Sequence | MATTGTAAVATGTSTVKRKPVFVKVEQLKPGTTGHTLTVKVIEANIVVPVTRKTRPASSL SRPSQPSRIVECLIGDETGCILFTARNDQVDLMKPGATVILRNSRIDMFKGTMRLGVDKW GRIEATGAASFTVKEDNNLSLVEYELINVGGDQ |
| Image |  |