1XO8 | |
PDB ID | 1XO8 |
Japanese name | シロイヌナズナ |
English name | Arabidopsis |
Scientific name | Arabidopsis thaliana (L.) Heynh. |
Protein name | Putative Desication Related Protein Lea14 |
Gene name | Name=F22l4.3; |
Source/Organism | Arabidopsis Thaliana |
Compound | Molecule: At1g01470; Chain: A; Engineered: Yes |
Classification | Structural Genomics, Unknown Function |
EC number | - |
Authors | S.Singh, C.C.Corneliscu, R.C.Tyler, G.Corneliscu, M.Tonelli, M.S.Lee, J.L.Markley, Center For Eukaryotic Structural Genomics (Cesg) |
Reference | S.Singh, C.C.Corneliscu, R.C.Tyler, G.Corneliscu, M.Tonelli, M.S.Lee, J.L.Markley, Center For Eukaryotic Structural Genomics Solution Structure Of At1g01470 From Arabidopsis Thaliana To Be Published |
Key word | Structural Genomics, Protein Structure Initiative, Center For Eukaryotic Structural Genomics, Psi, Cesg |
Cross reference | GB:AAT71983,50253562 EMBL; Y10085; CAA71174.1; -. EMBL; AY074855; AAL75906.1; -. EMBL; AC061957; AAF81307.1; -. EMBL; BT015111; AAT71983.1; -. EMBL; Y12776; CAA73311.1; -. PIR; D86145; D86145. GO; GO:0030288; C:periplasmic space (sensu Gram-negative Bact...; IEA. GO; GO:0005515; F:protein binding; IEA. GO; GO:0007047; P:cell wall organization and biogenesis; IEA. GO; GO:0009269; P:response to dessication; IEA. InterPro; IPR004864; LEA_2. InterPro; IPR001829; Pili_chaperone. Pfam; PF03168; LEA_2; 1. ProDom; PD010978; LEA_2; 1. |
Experimental method | Nmr, 20 Structures |
Sequence characteristics | Length: 151 AA, Molecular weight: 16543 Da |
Sequence | MASLLDKAKDFVADKLTAIPKPEGSVTDVDLKDVNRDSVEYLAKVSVTNPYSHSIPICEI SFTFHSAGREIGKGKIPDPGSLKAKDMTALDIPVVVPYSILFNLARDVGVDWDIDYELQI GLTIDLPVVGEFTIPISSKGEIKLPTFKDFF |
Image |