1XQ1 | |
PDB ID | 1XQ1 |
Japanese name | シロイヌナズナ |
English name | Arabidopsis |
Scientific name | Arabidopsis thaliana (L.) Heynh. |
Protein name | At1g07440/F22g5_16. |
Gene name | - |
Source/Organism | Arabidopsis Thaliana |
Compound | Molecule: Putative Tropinone Reducatse; Chain: A; Engineered: Yes |
Classification | Oxidoreductase |
EC number | - |
Authors | G.E.Wesenberg, D.W.Smith, G.N.Phillips Jr., E.Bitto, C.A.Bingman, S.T.M.Allard, Center For Eukaryotic Structural Genomics (Cesg) |
Reference | Center For Eukaryotic Structural Genomics X-Ray Structure Of Putative Tropinone Reducatse From Arabidopsis Thaliana Gene At1g07440 To Be Published |
Key word | Structural Genomics, Protein Structure Initiative, Cesg, At1g07440, Reductively Methylated Protein, Putative Tropinone Reductase, Psi, Center For Eukaryotic Structural Genomics |
Cross reference | GB:AAK32789,13605591 EMBL; AF361621; AAK32789.1; -. EMBL; AY055094; AAL05894.1; -. HSSP; P50162; 1AE1. GO; GO:0016491; F:oxidoreductase activity; IEA. GO; GO:0008152; P:metabolism; IEA. InterPro; IPR002198; ADH_short. InterPro; IPR002347; Adh_short_C2. Pfam; PF00106; adh_short; 1. PRINTS; PR00081; GDHRDH. PRINTS; PR00080; SDRFAMILY. PROSITE; PS00061; ADH_SHORT; 1. |
Experimental method | X-Ray Diffraction, Resolution: 2.10 Angstrom, R-Factor: 0.255, R-Free: 0.316 |
Sequence characteristics | Length: 266 AA, Molecular weight: 28332 Da |
Sequence | MAGAEQSQRWSLKAKTVLVTGGTKGIGHAIVEEFAGFGAVIHTCARNEYELNECLSKWQK KGFQVTGSVCDASLRPEREKLMQTVSSMFGGKLDILINNLGAIRSKPTLDYTAEDFSFHI STNLESAYHLSQLAHPLLKASGCGNIIFMSSIAGVVSASVGSIYSATKGALNQLARNLAC EWASDGIRANAVAPAVIATPLAEAVYDDEFKKVVISRKPLGRFGEPEEVSSLVAFLCMPA ASYITGQTICVDGGLTVNGFSYQPQG |
Image |