3NUL | |
PDB ID | 3NUL |
Japanese name | シロイヌナズナ |
English name | Arabidopsis |
Scientific name | Arabidopsis thaliana (L.) Heynh. |
Protein name | Profilin 1 |
Gene name | Name=Pro1; Synonyms=Pfn1, Prf1; Orderedlocusnames=At2g19760; Gn Orfnames=F6f22.21; |
Source/Organism | Arabidopsis Thaliana |
Compound | Molecule: Profilin I; Chain: Null; Engineered: Selenomethionyl Protein |
Classification | Actin-Binding Protein |
EC number | - |
Authors | K.Thorn, H.E.M.Christensen, R.Shigeta, D.Huddler, N.-H.Chua, L.Shalaby, U.Lindberg, C.E.Schutt |
Reference | K.S.Thorn, H.E.Christensen, R.Shigeta, D.Huddler, L.Shalaby, U.Lindberg, N.H.Chua, C.E.Schutt The Crystal Structure Of A Major Allergen From Plants Structure (London) V. 5 19 1997 |
Key word | Profilin, Cytoskeleton, Actin-Binding Protein |
Cross reference | GB:U43322,1353763 EMBL; U43325; AAB39480.1; -. EMBL; U43322; AAB39476.1; -. EMBL; U43593; AAG10090.1; -. EMBL; U43590; AAB46750.1; -. EMBL; AC005169; AAC62140.1; -. PIR; G84580; G84580. PDB; 1A0K; X-ray; @=1-131. PDB; 1PLM; Model; A=2-131. PDB; 3NUL; X-ray; @=2-131. InterPro; IPR002097; Profilin. InterPro; IPR005455; Profilin_plant. Pfam; PF00235; Profilin; 1. PRINTS; PR00392; PROFILIN. PRINTS; PR01640; PROFILINPLNT. SMART; SM00392; PROF; 1. PROSITE; PS00414; PROFILIN; 1. |
Experimental method | X-Ray Diffraction, Resolution: 1.6 Angstrom, R-Factor: 0.1808, R-Free: 0.2049 |
Sequence characteristics | Length: 131 AA, Molecular weight: 14266 Da |
Sequence | MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE RLGDYLIESEL |
Image |